PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 339aa    MW: 39076.9 Da    PI: 7.7273
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938117.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.7e-5371341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yL++++++ ++++ ++i+evdiyk++Pw+Lp+k+  +++ewyfFs+rd+ky++g r+nr+++sgyWkatg+dk++  +
  XP_010938117.1   7 LPPGFRFHPTDEELILHYLRNQAASLPCPV-SIIAEVDIYKFDPWELPAKAMFGDREWYFFSPRDRKYPNGMRPNRSAASGYWKATGTDKPIRLS 100
                     79****************************.89***************888889**************************************987 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++e++g+kk Lvfykgr pkg+kt+W+mheyrl
  XP_010938117.1 101 kGNENIGVKKALVFYKGRPPKGVKTNWIMHEYRL 134
                     57788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-655166IPR003441NAC domain
PROSITE profilePS5100561.9257166IPR003441NAC domain
PfamPF023655.1E-278134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MSDPTLLPPG FRFHPTDEEL ILHYLRNQAA SLPCPVSIIA EVDIYKFDPW ELPAKAMFGD  60
REWYFFSPRD RKYPNGMRPN RSAASGYWKA TGTDKPIRLS KGNENIGVKK ALVFYKGRPP  120
KGVKTNWIMH EYRLAEPENS NRYKPMRIRD SSMRLDDWVL CRIYKKSNHL PPVPPLIDRE  180
QEDSGTEDKY YSNLTNITQQ NPLRLPKSSS LSELLEDYSS IAHLFDNQPE MPGSSDHGSI  240
MGQPSSNQLF VNNSGNNNLV QQLHQAEPSA PNSENSLKRQ RMWDIHSEEN NGLLNHLKKR  300
NDSFIYPDFS NQFDTPNCNL LNQPFFSQQM LLNSHLGLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-73716817167NO APICAL MERISTEM PROTEIN
1ut4_B9e-73716817167NO APICAL MERISTEM PROTEIN
1ut7_A9e-73716817167NO APICAL MERISTEM PROTEIN
1ut7_B9e-73716817167NO APICAL MERISTEM PROTEIN
3swm_A1e-72716820170NAC domain-containing protein 19
3swm_B1e-72716820170NAC domain-containing protein 19
3swm_C1e-72716820170NAC domain-containing protein 19
3swm_D1e-72716820170NAC domain-containing protein 19
3swp_A1e-72716820170NAC domain-containing protein 19
3swp_B1e-72716820170NAC domain-containing protein 19
3swp_C1e-72716820170NAC domain-containing protein 19
3swp_D1e-72716820170NAC domain-containing protein 19
4dul_A9e-73716817167NAC domain-containing protein 19
4dul_B9e-73716817167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938117.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492553e-86NAC29_ARATH; NAC transcription factor 29
SwissprotA0SPJ95e-85NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLM0TC261e-156M0TC26_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P32320_0011e-155(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.15e-92NAC domain containing protein 47